Lineage for d3rpga1 (3rpg A:2-147)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2183823Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2184040Protein automated matches [190124] (12 species)
    not a true protein
  7. 2184055Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)
  8. 2184103Domain d3rpga1: 3rpg A:2-147 [185091]
    Other proteins in same PDB: d3rpga2
    automated match to d1x23a1
    complexed with zn

Details for d3rpga1

PDB Entry: 3rpg (more details), 2.65 Å

PDB Description: Bmi1/Ring1b-UbcH5c complex structure
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d3rpga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rpga1 d.20.1.1 (A:2-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrdkynrisrewtqkyam

SCOPe Domain Coordinates for d3rpga1:

Click to download the PDB-style file with coordinates for d3rpga1.
(The format of our PDB-style files is described here.)

Timeline for d3rpga1: