SCOPe 2.06: Domain d3rnka_: 3rnk A:

Lineage for d3rnka_ (3rnk A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)

8. Domain d3rnka_: 3rnk A: [185063]
   Other proteins in same PDB: d3rnkb_
   automated match to d1npua_
   mutant

Details for d3rnka_

PDB Entry: 3rnk, 1.74 Å

PDB Description: crystal structure of the complex between mouse pd-1 mutant and pd-l2 igv domain

PDB Compounds: (A:) Programmed cell death protein 1

SCOPe Domain Sequences for d3rnka_:

Sequence; same for both SEQRES and ATOM records:

>d3rnka_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpklkieespgaelvvt

Timeline for d3rnka_:

• d3rnka_ first appeared in SCOPe 2.01
  
• d3rnka_ appears in SCOPe 2.05
  
• d3rnka_ appears in SCOPe 2.07
  
• d3rnka_ appears in the current release, SCOPe 2.08