Lineage for d3rnka_ (3rnk A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513189Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)
  8. 1513218Domain d3rnka_: 3rnk A: [185063]
    automated match to d1npua_
    mutant

Details for d3rnka_

PDB Entry: 3rnk (more details), 1.74 Å

PDB Description: crystal structure of the complex between mouse pd-1 mutant and pd-l2 igv domain
PDB Compounds: (A:) Programmed cell death protein 1

SCOPe Domain Sequences for d3rnka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rnka_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpklkieespgaelvvt

SCOPe Domain Coordinates for d3rnka_:

Click to download the PDB-style file with coordinates for d3rnka_.
(The format of our PDB-style files is described here.)

Timeline for d3rnka_: