SCOPe 2.01: Domain d3rngc_: 3rng C:

Lineage for d3rngc_ (3rng C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.12: TmoB-like [110814] (2 families)
   possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.12.1: TmoB-like [110815] (1 protein)
   Pfam PF06234

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species)

7. Species Pseudomonas sp. [TaxId:320855] [189499] (10 PDB entries)

8. Domain d3rngc_: 3rng C: [185061]
   Other proteins in same PDB: d3rnga_, d3rngb_
   automated match to d1t0rc_
   complexed with fe, oh; mutant

Details for d3rngc_

PDB Entry: 3rng, 2.81 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase T201S/W167E Double Mutant

PDB Compounds: (C:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3rngc_:

Sequence; same for both SEQRES and ATOM records:

>d3rngc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas sp. [TaxId: 320855]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

Timeline for d3rngc_:

• d3rngc_ is new in SCOPe 2.01-stable
  
• d3rngc_ appears in SCOPe 2.02
  
• d3rngc_ appears in the current release, SCOPe 2.08