SCOP 1.71: Domain d1hcy_2: 1hcy 136-398

Lineage for d1hcy_2 (1hcy 136-398)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families)
   duplication: contains two structural repeats

5. Family a.86.1.1: Hemocyanin middle domain [48057] (2 proteins)

6. Protein Arthropod hemocyanin [48058] (2 species)
   N-terminal domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich

7. Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48060] (7 PDB entries)

8. Domain d1hcy_2: 1hcy 136-398 [18506]
   Other proteins in same PDB: d1hcy_1, d1hcy_3
   complexed with cu, nag

Details for d1hcy_2

PDB Entry: 1hcy, 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hcy_2:

Sequence; same for both SEQRES and ATOM records:

>d1hcy_2 a.86.1.1 (136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus)}
plyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqrvayfgedigmnihhv
twhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriireg
fapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidi
rqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetat
rdpsffrlhkymdnifkkhtdsf

Timeline for d1hcy_2:

• d1hcy_2 first appeared (with stable ids) in SCOP 1.55
  
• d1hcy_2 appears in SCOP 1.69
  
• d1hcy_2 is called d1hcya2 in SCOP 1.73
  
• d1hcy_2 appears in the current release, SCOPe 2.08, called d1hcya2