Lineage for d1hcy_2 (1hcy 136-398)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358134Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 358135Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families) (S)
    duplication: contains two structural repeats
  5. 358136Family a.86.1.1: Hemocyanin middle domain [48057] (2 proteins)
  6. 358137Protein Arthropod hemocyanin [48058] (2 species)
    N-terminal domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 358143Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48060] (7 PDB entries)
  8. 358150Domain d1hcy_2: 1hcy 136-398 [18506]
    Other proteins in same PDB: d1hcy_1, d1hcy_3
    complexed with cu, nag

Details for d1hcy_2

PDB Entry: 1hcy (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hcy_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcy_2 a.86.1.1 (136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus)}
plyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqrvayfgedigmnihhv
twhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriireg
fapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidi
rqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetat
rdpsffrlhkymdnifkkhtdsf

SCOP Domain Coordinates for d1hcy_2:

Click to download the PDB-style file with coordinates for d1hcy_2.
(The format of our PDB-style files is described here.)

Timeline for d1hcy_2: