Lineage for d1hcy_2 (1hcy 136-398)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily) Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families) 
Family a.86.1.1: Hemocyanin, middle domain [48057] (1 protein) Protein Hemocyanin, middle domain [48058] (2 species) 
Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48060] (7 PDB entries) 
Domain d1hcy_2: 1hcy 136-398 [18506]
Other proteins in same PDB: d1hcy_1, d1hcy_3
Details for d1hcy_2
PDB Entry: 1hcy (more details), 3.2 Å
PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution
SCOP Domain Sequences for d1hcy_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcy_2 a.86.1.1 (136-398) Hemocyanin, middle domain {Spiny lobster (Panulirus interruptus)}
plyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqrvayfgedigmnihhv
twhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriireg
fapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidi
rqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetat
rdpsffrlhkymdnifkkhtdsf
SCOP Domain Coordinates for d1hcy_2:
Click to download the PDB-style file with coordinates for d1hcy_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hcy_2:
- d1hcy_2 appears in SCOP 1.57
- d1hcy_2 appears in the current release, SCOPe 2.08, called d1hcya2
View in 3D
