SCOPe 2.05: Domain d3rneb_: 3rne B:

Lineage for d3rneb_ (3rne B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)

7. Species Pseudomonas sp. [TaxId:320855] [189498] (11 PDB entries)

8. Domain d3rneb_: 3rne B: [185054]
   Other proteins in same PDB: d3rnea_, d3rnec_
   automated match to d1t0rb_
   complexed with fe, oh; mutant

Details for d3rneb_

PDB Entry: 3rne, 2.5 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase T201S/I276E Double Mutant

PDB Compounds: (B:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3rneb_:

Sequence; same for both SEQRES and ATOM records:

>d3rneb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas sp. [TaxId: 320855]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmg

Timeline for d3rneb_:

• d3rneb_ first appeared in SCOPe 2.01
  
• d3rneb_ appears in SCOPe 2.04
  
• d3rneb_ appears in SCOPe 2.06
  
• d3rneb_ appears in the current release, SCOPe 2.08