Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.12: TmoB-like [110814] (2 families) possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
Family d.15.12.1: TmoB-like [110815] (1 protein) Pfam PF06234 |
Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species) |
Species Pseudomonas sp. [TaxId:320855] [189499] (10 PDB entries) |
Domain d3rncc_: 3rnc C: [185051] Other proteins in same PDB: d3rnca_, d3rncb_ automated match to d1t0rc_ complexed with edo, fe, oh; mutant |
PDB Entry: 3rnc (more details), 2.74 Å
SCOPe Domain Sequences for d3rncc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rncc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas sp. [TaxId: 320855]} tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf prgmivsdaglrptetldiifmd
Timeline for d3rncc_: