Lineage for d1hc1a2 (1hc1 A:136-398)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1274974Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 1274975Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families) (S)
    duplication: contains two structural repeats
  5. 1274976Family a.86.1.1: Hemocyanin middle domain [48057] (2 proteins)
  6. 1274977Protein Arthropod hemocyanin [48058] (2 species)
    N-terminal domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 1274983Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48060] (2 PDB entries)
  8. 1274984Domain d1hc1a2: 1hc1 A:136-398 [18505]
    Other proteins in same PDB: d1hc1a1, d1hc1a3
    complexed with cu

Details for d1hc1a2

PDB Entry: 1hc1 (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution
PDB Compounds: (A:) arthropodan hemocyanin

SCOPe Domain Sequences for d1hc1a2:

Sequence, based on SEQRES records: (download)

>d1hc1a2 a.86.1.1 (A:136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
plyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqrvayfgedigmnihhv
twhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriireg
fapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidi
rqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetat
rdpsffrlhkymdnifkkhtdsf

Sequence, based on observed residues (ATOM records): (download)

>d1hc1a2 a.86.1.1 (A:136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
plyqitphmftnsevidkaysakmtqkpgtfnvsfknreqrvayfgedigmnihhvtwhm
dfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriiregfapl
tsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidirqpk
giellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetatrdps
ffrlhkymdnifkkhtdsf

SCOPe Domain Coordinates for d1hc1a2:

Click to download the PDB-style file with coordinates for d1hc1a2.
(The format of our PDB-style files is described here.)

Timeline for d1hc1a2: