Lineage for d1hc1a2 (1hc1 A:136-398)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644714Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 644715Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families) (S)
    duplication: contains two structural repeats
  5. 644716Family a.86.1.1: Hemocyanin middle domain [48057] (2 proteins)
  6. 644717Protein Arthropod hemocyanin [48058] (2 species)
    N-terminal domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 644723Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48060] (7 PDB entries)
  8. 644729Domain d1hc1a2: 1hc1 A:136-398 [18505]
    Other proteins in same PDB: d1hc1a1, d1hc1a3
    complexed with cu

Details for d1hc1a2

PDB Entry: 1hc1 (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution
PDB Compounds: (A:) arthropodan hemocyanin

SCOP Domain Sequences for d1hc1a2:

Sequence, based on SEQRES records: (download)

>d1hc1a2 a.86.1.1 (A:136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
plyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqrvayfgedigmnihhv
twhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriireg
fapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidi
rqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetat
rdpsffrlhkymdnifkkhtdsf

Sequence, based on observed residues (ATOM records): (download)

>d1hc1a2 a.86.1.1 (A:136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
plyqitphmftnsevidkaysakmtqkpgtfnvsfknreqrvayfgedigmnihhvtwhm
dfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriiregfapl
tsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidirqpk
giellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetatrdps
ffrlhkymdnifkkhtdsf

SCOP Domain Coordinates for d1hc1a2:

Click to download the PDB-style file with coordinates for d1hc1a2.
(The format of our PDB-style files is described here.)

Timeline for d1hc1a2: