Lineage for d1hc1_2 (1hc1 136-398)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283520Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 283521Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families) (S)
    duplication: contains two structural repeats
  5. 283522Family a.86.1.1: Hemocyanin middle domain [48057] (2 proteins)
  6. 283523Protein Arthropod hemocyanin [48058] (2 species)
    N-terminal domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 283529Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48060] (7 PDB entries)
  8. 283535Domain d1hc1_2: 1hc1 136-398 [18505]
    Other proteins in same PDB: d1hc1_1, d1hc1_3
    complexed with cu

Details for d1hc1_2

PDB Entry: 1hc1 (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hc1_2:

Sequence, based on SEQRES records: (download)

>d1hc1_2 a.86.1.1 (136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus)}
plyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqrvayfgedigmnihhv
twhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriireg
fapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidi
rqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetat
rdpsffrlhkymdnifkkhtdsf

Sequence, based on observed residues (ATOM records): (download)

>d1hc1_2 a.86.1.1 (136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus)}
plyqitphmftnsevidkaysakmtqkpgtfnvsfknreqrvayfgedigmnihhvtwhm
dfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriiregfapl
tsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidirqpk
giellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetatrdps
ffrlhkymdnifkkhtdsf

SCOP Domain Coordinates for d1hc1_2:

Click to download the PDB-style file with coordinates for d1hc1_2.
(The format of our PDB-style files is described here.)

Timeline for d1hc1_2: