Lineage for d3rnbc_ (3rnb C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639834Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 1639835Family d.15.12.1: TmoB-like [110815] (1 protein)
    Pfam PF06234
  6. 1639836Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species)
  7. 1639837Species Pseudomonas sp. [TaxId:320855] [189499] (11 PDB entries)
  8. 1639844Domain d3rnbc_: 3rnb C: [185048]
    Other proteins in same PDB: d3rnba_, d3rnbb_
    automated match to d1t0rc_
    complexed with fe, oh, so4; mutant

Details for d3rnbc_

PDB Entry: 3rnb (more details), 2.64 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase T201S/F176W Double Mutant
PDB Compounds: (C:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3rnbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rnbc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas sp. [TaxId: 320855]}
atfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtl
fprgmivsdaglrptetldiifmdn

SCOPe Domain Coordinates for d3rnbc_:

Click to download the PDB-style file with coordinates for d3rnbc_.
(The format of our PDB-style files is described here.)

Timeline for d3rnbc_: