SCOPe 2.02: Domain d3rnbb_: 3rnb B:

Lineage for d3rnbb_ (3rnb B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)

7. Species Pseudomonas sp. [TaxId:320855] [189498] (10 PDB entries)

8. Domain d3rnbb_: 3rnb B: [185047]
   Other proteins in same PDB: d3rnba_, d3rnbc_
   automated match to d1t0rb_
   complexed with fe, oh, so4; mutant

Details for d3rnbb_

PDB Entry: 3rnb, 2.64 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase T201S/F176W Double Mutant

PDB Compounds: (B:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3rnbb_:

Sequence; same for both SEQRES and ATOM records:

>d3rnbb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas sp. [TaxId: 320855]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmgl

Timeline for d3rnbb_:

• d3rnbb_ first appeared in SCOPe 2.01
  
• d3rnbb_ appears in SCOPe 2.03
  
• d3rnbb_ appears in the current release, SCOPe 2.08