Lineage for d3rn0c_ (3rn0 C:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585672Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2585673Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2585674Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 2585731Protein automated matches [190303] (3 species)
    not a true protein
  7. 2585750Species Paracoccus denitrificans [TaxId:318586] [189284] (9 PDB entries)
  8. 2585759Domain d3rn0c_: 3rn0 C: [185038]
    Other proteins in same PDB: d3rn0d_, d3rn0f_
    automated match to d1mg2b_
    complexed with ca, hec, mes, na, p6g, pg4

Details for d3rn0c_

PDB Entry: 3rn0 (more details), 1.91 Å

PDB Description: Crystal Structure of the W199K-MauG/pre-Methylamine Dehydrogenase Complex
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3rn0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rn0c_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3rn0c_:

Click to download the PDB-style file with coordinates for d3rn0c_.
(The format of our PDB-style files is described here.)

Timeline for d3rn0c_: