SCOPe 2.02: Domain d3rmub_: 3rmu B:

Lineage for d3rmub_ (3rmu B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189952] (1 PDB entry)

8. Domain d3rmub_: 3rmu B: [185031]
   automated match to d1jc4a_
   complexed with co, edo, pg4

Details for d3rmub_

PDB Entry: 3rmu, 1.8 Å

PDB Description: Crystal structure of human Methylmalonyl-CoA epimerase, MCEE

PDB Compounds: (B:) Methylmalonyl-CoA epimerase, mitochondrial

SCOPe Domain Sequences for d3rmub_:

Sequence; same for both SEQRES and ATOM records:

>d3rmub_ d.32.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smlgrlnhvaiavpdlekaaafyknilgaqvseavplpehgvsvvfvnlgntkmellhpl
gldspiagflqknkaggmhhicievdninaavmdlkkkkirslseevkigahgkpviflh
pkdcggvlveleqa

Timeline for d3rmub_:

• d3rmub_ first appeared in SCOPe 2.01
  
• d3rmub_ appears in SCOPe 2.03
  
• d3rmub_ appears in the current release, SCOPe 2.08, called d3rmub1