Lineage for d1hc3_2 (1hc3 136-398)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5115Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
  4. 5116Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families) (S)
  5. 5117Family a.86.1.1: Hemocyanin, middle domain [48057] (1 protein)
  6. 5118Protein Hemocyanin, middle domain [48058] (2 species)
  7. 5124Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48060] (7 PDB entries)
  8. 5126Domain d1hc3_2: 1hc3 136-398 [18503]
    Other proteins in same PDB: d1hc3_1, d1hc3_3

Details for d1hc3_2

PDB Entry: 1hc3 (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hc3_2:

Sequence, based on SEQRES records: (download)

>d1hc3_2 a.86.1.1 (136-398) Hemocyanin, middle domain {Spiny lobster (Panulirus interruptus)}
plyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqrvayfgedigmnihhv
twhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriireg
fapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidi
rqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetat
rdpsffrlhkymdnifkkhtdsf

Sequence, based on observed residues (ATOM records): (download)

>d1hc3_2 a.86.1.1 (136-398) Hemocyanin, middle domain {Spiny lobster (Panulirus interruptus)}
plyqitphmftnsevidkaysakmtqkpgtfnvsfknreqrvayfgedigmnihhvtwhm
dfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriiregfapl
tsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidirqpk
giellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetatrdps
ffrlhkymdnifkkhtdsf

SCOP Domain Coordinates for d1hc3_2:

Click to download the PDB-style file with coordinates for d1hc3_2.
(The format of our PDB-style files is described here.)

Timeline for d1hc3_2: