Lineage for d3rlpb_ (3rlp B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924588Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1924589Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1924590Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 1924591Protein HSP90 [55876] (3 species)
  7. 1924669Species Human (Homo sapiens) [TaxId:9606] [55878] (80 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 1924694Domain d3rlpb_: 3rlp B: [185025]
    automated match to d1osfa_
    complexed with 3rp, po4

Details for d3rlpb_

PDB Entry: 3rlp (more details), 1.7 Å

PDB Description: Co-crystal structure of the HSP90 ATP binding domain in complex with 4-(2,4-dichloro-5-methoxyphenyl)-6-methylpyrimidin-2-amine
PDB Compounds: (B:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3rlpb_:

Sequence, based on SEQRES records: (download)

>d3rlpb_ d.122.1.1 (B:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
hlkedqteyleerrikeivkkhsqfigypitlfvekelehhh

Sequence, based on observed residues (ATOM records): (download)

>d3rlpb_ d.122.1.1 (B:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtitkafmealqagadismig
qfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlke
dqteyleerrikeivkkhsqfigypitlfvekelehhh

SCOPe Domain Coordinates for d3rlpb_:

Click to download the PDB-style file with coordinates for d3rlpb_.
(The format of our PDB-style files is described here.)

Timeline for d3rlpb_: