SCOPe 2.01: Domain d3rlpa_: 3rlp A:

Lineage for d3rlpa_ (3rlp A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein HSP90 [55876] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55878] (53 PDB entries)
   Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223

8. Domain d3rlpa_: 3rlp A: [185024]
   automated match to d1osfa_
   complexed with 3rp, po4

Details for d3rlpa_

PDB Entry: 3rlp, 1.7 Å

PDB Description: Co-crystal structure of the HSP90 ATP binding domain in complex with 4-(2,4-dichloro-5-methoxyphenyl)-6-methylpyrimidin-2-amine

PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3rlpa_:

Sequence; same for both SEQRES and ATOM records:

>d3rlpa_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
qpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpsk
ldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadis
migqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilh
lkedqteyleerrikeivkkhsqfigypitlfvekel

Timeline for d3rlpa_:

• d3rlpa_ is new in SCOPe 2.01-stable
  
• d3rlpa_ appears in SCOPe 2.02
  
• d3rlpa_ appears in the current release, SCOPe 2.08, called d3rlpa1