Lineage for d3rlme_ (3rlm E:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585672Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2585673Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2585674Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 2585731Protein automated matches [190303] (3 species)
    not a true protein
  7. 2585750Species Paracoccus denitrificans [TaxId:318586] [189284] (9 PDB entries)
  8. 2585768Domain d3rlme_: 3rlm E: [185023]
    Other proteins in same PDB: d3rlmc2, d3rlmd_, d3rlmf_
    automated match to d1mg2b_
    complexed with act, ca, hec, pge

Details for d3rlme_

PDB Entry: 3rlm (more details), 2.13 Å

PDB Description: Structure of the W199F MauG/pre-Methylamine Dehydrogenase complex after treatment with hydrogen peroxide
PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3rlme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rlme_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3rlme_:

Click to download the PDB-style file with coordinates for d3rlme_.
(The format of our PDB-style files is described here.)

Timeline for d3rlme_: