Lineage for d1hc4_2 (1hc4 136-398)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445699Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 445700Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families) (S)
    duplication: contains two structural repeats
  5. 445701Family a.86.1.1: Hemocyanin middle domain [48057] (2 proteins)
  6. 445702Protein Arthropod hemocyanin [48058] (2 species)
    N-terminal domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 445708Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48060] (7 PDB entries)
  8. 445710Domain d1hc4_2: 1hc4 136-398 [18502]
    Other proteins in same PDB: d1hc4_1, d1hc4_3

Details for d1hc4_2

PDB Entry: 1hc4 (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hc4_2:

Sequence, based on SEQRES records: (download)

>d1hc4_2 a.86.1.1 (136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus)}
plyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqrvayfgedigmnihhv
twhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriireg
fapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidi
rqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetat
rdpsffrlhkymdnifkkhtdsf

Sequence, based on observed residues (ATOM records): (download)

>d1hc4_2 a.86.1.1 (136-398) Arthropod hemocyanin {Spiny lobster (Panulirus interruptus)}
plyqitphmftnsevidkaysakmtqkpgtfnvsfknreqrvayfgedigmnihhvtwhm
dfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriiregfapl
tsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidirqpk
giellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetatrdps
ffrlhkymdnifkkhtdsf

SCOP Domain Coordinates for d1hc4_2:

Click to download the PDB-style file with coordinates for d1hc4_2.
(The format of our PDB-style files is described here.)

Timeline for d1hc4_2: