SCOPe 2.08: Domain d3rk8b_: 3rk8 B:

Lineage for d3rk8b_ (3rk8 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (94 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [189578] (10 PDB entries)

8. Domain d3rk8b_: 3rk8 B: [185002]
   automated match to d1dhpa_
   complexed with cl, gol, peg, pyr

Details for d3rk8b_

PDB Entry: 3rk8, 1.8 Å

PDB Description: Crystal structure of the chloride inhibited dihydrodipicolinate synthase from Acinetobacter baumannii complexed with pyruvate at 1.8 A resolution

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3rk8b_:

Sequence; same for both SEQRES and ATOM records:

>d3rk8b_ c.1.10.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
tiqgsivaivtpmlkdggvdwksleklvewhieqgtnsivavgttgeastlsmeehtqvi
keiirvankripiiagtganstreaieltkaakdlgadaallvtpyynkptqeglyqhyk
aiaeavelplilynvpgrtgvdlsndtavrlaeipnivgikdatgdvprgkalidalngk
mavysgddetawelmllgadgnisvtaniapkamsevcavaiakdeqqaktlnnkianlh
nilfcesnpipvkwalhemglidtgirlpltplaeqyreplrnalkdagii

Timeline for d3rk8b_:

• d3rk8b_ first appeared in SCOPe 2.01
  
• d3rk8b_ appears in SCOPe 2.07