Lineage for d1hc2_2 (1hc2 136-398)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215714Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 215715Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families) (S)
    duplication: contains two structural repeats
  5. 215716Family a.86.1.1: Hemocyanin middle domain [48057] (2 proteins)
  6. 215721Protein Hemocyanin [48058] (2 species)
    N-terminal domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 215727Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48060] (7 PDB entries)
  8. 215728Domain d1hc2_2: 1hc2 136-398 [18500]
    Other proteins in same PDB: d1hc2_1, d1hc2_3
    complexed with cu

Details for d1hc2_2

PDB Entry: 1hc2 (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hc2_2:

Sequence, based on SEQRES records: (download)

>d1hc2_2 a.86.1.1 (136-398) Hemocyanin {Spiny lobster (Panulirus interruptus)}
plyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqrvayfgedigmnihhv
twhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriireg
fapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidi
rqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetat
rdpsffrlhkymdnifkkhtdsf

Sequence, based on observed residues (ATOM records): (download)

>d1hc2_2 a.86.1.1 (136-398) Hemocyanin {Spiny lobster (Panulirus interruptus)}
plyqitphmftnsevidkaysakmtqkpgtfnvsfknreqrvayfgedigmnihhvtwhm
dfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhwdriiregfapl
tsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitdsdghtidirqpk
giellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvmehfetatrdps
ffrlhkymdnifkkhtdsf

SCOP Domain Coordinates for d1hc2_2:

Click to download the PDB-style file with coordinates for d1hc2_2.
(The format of our PDB-style files is described here.)

Timeline for d1hc2_2: