SCOPe 2.05: Domain d3risb_: 3ris B:

Lineage for d3risb_ (3ris B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (30 PDB entries)

8. Domain d3risb_: 3ris B: [184991]
   automated match to d1ucha_
   complexed with gol, so4

Details for d3risb_

PDB Entry: 3ris, 2.4 Å

PDB Description: Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme

PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase isozyme L5

SCOPe Domain Sequences for d3risb_:

Sequence, based on SEQRES records:

>d3risb_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
svvqdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
glalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrlyeldglregpi
dlgacnqddwisavrpviekriqkysegeirfnlmaivsdrkmiyeqkiaelq

Sequence, based on observed residues (ATOM records):

>d3risb_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
svvqdsrldtiffakqvinnacatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
glalsnsdvirqvhnsfarqqmfefdtedafhfvsyvpvngrlyeldglregpidlgacn
qddwisavrpviekriqkysegeirfnlmaivsdrkmiyeqkiaelq

Timeline for d3risb_:

• d3risb_ first appeared in SCOPe 2.01
  
• d3risb_ appears in SCOPe 2.04
  
• d3risb_ appears in SCOPe 2.06
  
• d3risb_ appears in the current release, SCOPe 2.08