Lineage for d1nol_2 (1nol 110-379)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5115Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
  4. 5116Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families) (S)
  5. 5117Family a.86.1.1: Hemocyanin, middle domain [48057] (1 protein)
  6. 5118Protein Hemocyanin, middle domain [48058] (2 species)
  7. 5119Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48059] (4 PDB entries)
  8. 5122Domain d1nol_2: 1nol 110-379 [18498]
    Other proteins in same PDB: d1nol_1, d1nol_3

Details for d1nol_2

PDB Entry: 1nol (more details), 2.4 Å

PDB Description: oxygenated hemocyanin (subunit type ii)

SCOP Domain Sequences for d1nol_2:

Sequence, based on SEQRES records: (download)

>d1nol_2 a.86.1.1 (110-379) Hemocyanin, middle domain {Horseshoe crab (Limulus polyphemus)}
pvqeifpdkfipsaaineafkkahvrpefdespilvdvqdtgnildpeyrlayyredvgi
nahhwhwhlvypstwnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnf
deplagyaphlthvasgkyysprpdglklrdlgdieisemvrmrerildsihlgyvised
gshktldelhgtdilgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvms
dtstslrdpifynwhrfidnifheykntlk

Sequence, based on observed residues (ATOM records): (download)

>d1nol_2 a.86.1.1 (110-379) Hemocyanin, middle domain {Horseshoe crab (Limulus polyphemus)}
pvqeifpdkfipsaaineafkkahdespilvdvqdtgnildpeyrlayyredvginahhw
hwhlvypstwnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnfdepla
gyaphlthvasgkyysprpdglklrdlgdieisemvrmrerildsihlgyvisedgshkt
ldelhgtdilgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvmsdtsts
lrdpifynwhrfidnifheykntlk

SCOP Domain Coordinates for d1nol_2:

Click to download the PDB-style file with coordinates for d1nol_2.
(The format of our PDB-style files is described here.)

Timeline for d1nol_2: