Lineage for d1oxy_2 (1oxy 110-379)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99476Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
  4. 99477Superfamily a.86.1: Di-copper centre-containing domain [48056] (2 families) (S)
  5. 99478Family a.86.1.1: Hemocyanin middle domain [48057] (2 proteins)
  6. 99483Protein Hemocyanin [48058] (2 species)
  7. 99484Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48059] (4 PDB entries)
  8. 99486Domain d1oxy_2: 1oxy 110-379 [18497]
    Other proteins in same PDB: d1oxy_1, d1oxy_3

Details for d1oxy_2

PDB Entry: 1oxy (more details), 2.4 Å

PDB Description: crystallographic analysis of oxygenated and deoxygenated states of arthropod hemocyanin shows unusual differences

SCOP Domain Sequences for d1oxy_2:

Sequence, based on SEQRES records: (download)

>d1oxy_2 a.86.1.1 (110-379) Hemocyanin {Horseshoe crab (Limulus polyphemus)}
pvqeifpdkfipsaaineafkkahvrpefdespilvdvqdtgnildpeyrlayyredvgi
nahhwhwhlvypstwnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnf
deplagyaphlthvasgkyysprpdglklrdlgdieisemvrmrerildsihlgyvised
gshktldelhgtdilgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvms
dtstslrdpifynwhrfidnifheykntlk

Sequence, based on observed residues (ATOM records): (download)

>d1oxy_2 a.86.1.1 (110-379) Hemocyanin {Horseshoe crab (Limulus polyphemus)}
pvqeifpdkfipsaaineafkkgnildpeyrlayyredvginahhwhwhlvypstwnpky
fgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnfdeplagyaphlthvasgky
ysprpdglklrdlgdieisemvrmrerildsihlgyvisedgshktldelhgtdilgalv
essyesvnheyygnlhnwghvtmarihdpdgrfheepgvmsdtstslrdpifynwhrfid
nifheykntlk

SCOP Domain Coordinates for d1oxy_2:

Click to download the PDB-style file with coordinates for d1oxy_2.
(The format of our PDB-style files is described here.)

Timeline for d1oxy_2: