SCOPe 2.04: Domain d3rghb_: 3rgh B:

Lineage for d3rghb_ (3rgh B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (39 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186988] (9 PDB entries)

8. Domain d3rghb_: 3rgh B: [184951]
   automated match to d2diaa1
   complexed with act

Details for d3rghb_

PDB Entry: 3rgh, 2.44 Å

PDB Description: Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

PDB Compounds: (B:) Filamin-A

SCOPe Domain Sequences for d3rghb_:

Sequence; same for both SEQRES and ATOM records:

>d3rghb_ b.1.18.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpfdaskvkcsgpgleratagevgqfqvdcssagsaeltieicseaglpaevyiqdhgdg
thtityiplcpgaytvtikyggqpvpnfpsklqvepa

Timeline for d3rghb_:

• d3rghb_ first appeared in SCOPe 2.01
  
• d3rghb_ appears in SCOPe 2.03
  
• d3rghb_ appears in SCOPe 2.05
  
• d3rghb_ appears in the current release, SCOPe 2.08, called d3rghb1