Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (39 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186988] (9 PDB entries) |
Domain d3rghb_: 3rgh B: [184951] automated match to d2diaa1 complexed with act |
PDB Entry: 3rgh (more details), 2.44 Å
SCOPe Domain Sequences for d3rghb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rghb_ b.1.18.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpfdaskvkcsgpgleratagevgqfqvdcssagsaeltieicseaglpaevyiqdhgdg thtityiplcpgaytvtikyggqpvpnfpsklqvepa
Timeline for d3rghb_: