Lineage for d3rgha_ (3rgh A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 938263Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 938264Protein automated matches [190226] (3 species)
    not a true protein
  7. 938267Species Human (Homo sapiens) [TaxId:9606] [186988] (3 PDB entries)
  8. 938270Domain d3rgha_: 3rgh A: [184950]
    automated match to d2diaa1
    complexed with act

Details for d3rgha_

PDB Entry: 3rgh (more details), 2.44 Å

PDB Description: Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens
PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d3rgha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rgha_ b.1.18.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdpfdaskvkcsgpgleratagevgqfqvdcssagsaeltieicseaglpaevyiqdhgd
gthtityiplcpgaytvtikyggqpvpnfpsklqvepa

SCOPe Domain Coordinates for d3rgha_:

Click to download the PDB-style file with coordinates for d3rgha_.
(The format of our PDB-style files is described here.)

Timeline for d3rgha_: