Lineage for d1hcy_1 (1hcy 1-135)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445682Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
    6 helices; bundle; one central helix is surrounded by 5 others
  4. 445683Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) (S)
  5. 445684Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)
  6. 445685Protein Hemocyanin, N-terminal domain [48052] (2 species)
    Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 445691Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48054] (7 PDB entries)
  8. 445698Domain d1hcy_1: 1hcy 1-135 [18495]
    Other proteins in same PDB: d1hcy_2, d1hcy_3

Details for d1hcy_1

PDB Entry: 1hcy (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hcy_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcy_1 a.85.1.1 (1-135) Hemocyanin, N-terminal domain {Spiny lobster (Panulirus interruptus)}
dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
vsvihsklgdgivlp

SCOP Domain Coordinates for d1hcy_1:

Click to download the PDB-style file with coordinates for d1hcy_1.
(The format of our PDB-style files is described here.)

Timeline for d1hcy_1: