Lineage for d1hc1a1 (1hc1 A:5-135)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719399Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
    6 helices; bundle; one central helix is surrounded by 5 others
  4. 2719400Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) (S)
    automatically mapped to Pfam PF03722
  5. 2719401Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)
  6. 2719402Protein Hemocyanin, N-terminal domain [48052] (2 species)
    Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 2719408Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48054] (2 PDB entries)
  8. 2719409Domain d1hc1a1: 1hc1 A:5-135 [18494]
    Other proteins in same PDB: d1hc1a2, d1hc1a3
    complexed with cu

Details for d1hc1a1

PDB Entry: 1hc1 (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution
PDB Compounds: (A:) arthropodan hemocyanin

SCOPe Domain Sequences for d1hc1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hc1a1 a.85.1.1 (A:5-135) Hemocyanin, N-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
tgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkelndhr
lleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyalyvsvi
hsklgdgivlp

SCOPe Domain Coordinates for d1hc1a1:

Click to download the PDB-style file with coordinates for d1hc1a1.
(The format of our PDB-style files is described here.)

Timeline for d1hc1a1: