SCOP 1.73: Domain d1hc4a1: 1hc4 A:5-135

Lineage for d1hc4a1 (1hc4 A:5-135)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
   6 helices; bundle; one central helix is surrounded by 5 others

4. Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family)

5. Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)

6. Protein Hemocyanin, N-terminal domain [48052] (2 species)
   Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich

7. Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48054] (7 PDB entries)

8. Domain d1hc4a1: 1hc4 A:5-135 [18491]
   Other proteins in same PDB: d1hc4a2, d1hc4a3
   complexed with cu

Details for d1hc4a1

PDB Entry: 1hc4, 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

PDB Compounds: (A:) arthropodan hemocyanin

SCOP Domain Sequences for d1hc4a1:

Sequence; same for both SEQRES and ATOM records:

>d1hc4a1 a.85.1.1 (A:5-135) Hemocyanin, N-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
tgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkelndhr
lleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyalyvsvi
hsklgdgivlp

Timeline for d1hc4a1:

• d1hc4a1 first appeared (with stable ids) in SCOP 1.55, called d1hc4_1
  
• d1hc4a1 was called d1hc4_1 in SCOP 1.71
  
• d1hc4a1 does not appear in SCOP 1.75