Lineage for d1hc4_1 (1hc4 5-135)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358117Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
    6 helices; bundle; one central helix is surrounded by 5 others
  4. 358118Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) (S)
  5. 358119Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)
  6. 358120Protein Hemocyanin, N-terminal domain [48052] (2 species)
    Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 358126Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48054] (7 PDB entries)
  8. 358128Domain d1hc4_1: 1hc4 5-135 [18491]
    Other proteins in same PDB: d1hc4_2, d1hc4_3
    complexed with cu

Details for d1hc4_1

PDB Entry: 1hc4 (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hc4_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hc4_1 a.85.1.1 (5-135) Hemocyanin, N-terminal domain {Spiny lobster (Panulirus interruptus)}
tgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkelndhr
lleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyalyvsvi
hsklgdgivlp

SCOP Domain Coordinates for d1hc4_1:

Click to download the PDB-style file with coordinates for d1hc4_1.
(The format of our PDB-style files is described here.)

Timeline for d1hc4_1: