Lineage for d1hc5_1 (1hc5 5-135)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283503Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
    6 helices; bundle; one central helix is surrounded by 5 others
  4. 283504Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) (S)
  5. 283505Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)
  6. 283506Protein Hemocyanin, N-terminal domain [48052] (2 species)
    Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 283512Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48054] (7 PDB entries)
  8. 283516Domain d1hc5_1: 1hc5 5-135 [18490]
    Other proteins in same PDB: d1hc5_2, d1hc5_3
    complexed with cu

Details for d1hc5_1

PDB Entry: 1hc5 (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hc5_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hc5_1 a.85.1.1 (5-135) Hemocyanin, N-terminal domain {Spiny lobster (Panulirus interruptus)}
tgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkelndhr
lleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyalyvsvi
hsklgdgivlp

SCOP Domain Coordinates for d1hc5_1:

Click to download the PDB-style file with coordinates for d1hc5_1.
(The format of our PDB-style files is described here.)

Timeline for d1hc5_1: