Lineage for d3rd2a1 (3rd2 A:345-419)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178753Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)
  8. 2178755Domain d3rd2a1: 3rd2 A:345-419 [184885]
    Other proteins in same PDB: d3rd2a2
    automated match to d1u4aa1

Details for d3rd2a1

PDB Entry: 3rd2 (more details), 1.6 Å

PDB Description: NIP45 SUMO-like Domain 2
PDB Compounds: (A:) NFATC2-interacting protein

SCOPe Domain Sequences for d3rd2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rd2a1 d.15.1.0 (A:345-419) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqqlqlrvqgkekhqtlevslsrdsplktlmshyeeamglsgrklsfffdgtklsgrelp
adlgmesgdlievwg

SCOPe Domain Coordinates for d3rd2a1:

Click to download the PDB-style file with coordinates for d3rd2a1.
(The format of our PDB-style files is described here.)

Timeline for d3rd2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rd2a2