Lineage for d3rd2a_ (3rd2 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1403010Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1403011Protein automated matches [190233] (6 species)
    not a true protein
  7. 1403019Species Human (Homo sapiens) [TaxId:9606] [187090] (15 PDB entries)
  8. 1403022Domain d3rd2a_: 3rd2 A: [184885]
    automated match to d1u4aa1

Details for d3rd2a_

PDB Entry: 3rd2 (more details), 1.6 Å

PDB Description: NIP45 SUMO-like Domain 2
PDB Compounds: (A:) NFATC2-interacting protein

SCOPe Domain Sequences for d3rd2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rd2a_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mhhhhhhsqqlqlrvqgkekhqtlevslsrdsplktlmshyeeamglsgrklsfffdgtk
lsgrelpadlgmesgdlievwg

SCOPe Domain Coordinates for d3rd2a_:

Click to download the PDB-style file with coordinates for d3rd2a_.
(The format of our PDB-style files is described here.)

Timeline for d3rd2a_: