Class a: All alpha proteins [46456] (289 folds) |
Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily) 6 helices; bundle; one central helix is surrounded by 5 others |
Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) automatically mapped to Pfam PF03722 |
Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein) |
Protein Hemocyanin, N-terminal domain [48052] (2 species) Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich |
Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48053] (4 PDB entries) |
Domain d1ll1a1: 1ll1 A:1-109 [18488] Other proteins in same PDB: d1ll1a2, d1ll1a3 complexed with cl, cu |
PDB Entry: 1ll1 (more details), 2.55 Å
SCOPe Domain Sequences for d1ll1a1:
Sequence, based on SEQRES records: (download)
>d1ll1a1 a.85.1.1 (A:1-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} tlhdkqirvchlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhl yevfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvp
>d1ll1a1 a.85.1.1 (A:1-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} tlhdkqirvchlfeqlssatvirlknvgklqpgaifscfhpdhleearhlyevfweagdf ndfieiakeartfvneglfafaaevavlhrddckglyvp
Timeline for d1ll1a1: