SCOPe 2.03: Domain d1llaa1: 1lla A:2-109

Lineage for d1llaa1 (1lla A:2-109)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
   6 helices; bundle; one central helix is surrounded by 5 others

4. Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family)
   automatically mapped to Pfam PF03722

5. Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)

6. Protein Hemocyanin, N-terminal domain [48052] (2 species)
   Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48053] (4 PDB entries)

8. Domain d1llaa1: 1lla A:2-109 [18485]
   Other proteins in same PDB: d1llaa2, d1llaa3
   complexed with cl, cu, na

Details for d1llaa1

PDB Entry: 1lla, 2.18 Å

PDB Description: crystal structure of deoxygenated limulus polyphemus subunit ii hemocyanin at 2.18 angstroms resolution: clues for a mechanism for allosteric regulation

PDB Compounds: (A:) hemocyanin (subunit type II)

SCOPe Domain Sequences for d1llaa1:

Sequence, based on SEQRES records:

>d1llaa1 a.85.1.1 (A:2-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
lhdkqirichlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhly
evfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvp

Sequence, based on observed residues (ATOM records):

>d1llaa1 a.85.1.1 (A:2-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
lhdkqirichlfeqlssathsdrlknvgklqpgaifscfhpdhleearhlyevfweagdf
ndfieiakeartfvneglfafaaevavlhrddckglyvp

Timeline for d1llaa1:

• d1llaa1 first appeared (with stable ids) in SCOP 1.55, called d1lla_1
  
• d1llaa1 appears in SCOPe 2.02
  
• d1llaa1 appears in SCOPe 2.04
  
• d1llaa1 appears in the current release, SCOPe 2.08