![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily) 6 helices; bundle; one central helix is surrounded by 5 others |
![]() | Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) ![]() automatically mapped to Pfam PF03722 |
![]() | Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein) |
![]() | Protein Hemocyanin, N-terminal domain [48052] (2 species) Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich |
![]() | Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48053] (4 PDB entries) |
![]() | Domain d1llaa1: 1lla A:2-109 [18485] Other proteins in same PDB: d1llaa2, d1llaa3 complexed with cl, cu, na |
PDB Entry: 1lla (more details), 2.18 Å
SCOPe Domain Sequences for d1llaa1:
Sequence, based on SEQRES records: (download)
>d1llaa1 a.85.1.1 (A:2-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} lhdkqirichlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhly evfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvp
>d1llaa1 a.85.1.1 (A:2-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} lhdkqirichlfeqlssathsdrlknvgklqpgaifscfhpdhleearhlyevfweagdf ndfieiakeartfvneglfafaaevavlhrddckglyvp
Timeline for d1llaa1: