Lineage for d3r4nb1 (3r4n B:9-225)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973217Protein HSP90 [55876] (3 species)
  7. 2973319Species Human (Homo sapiens) [TaxId:9606] [55878] (189 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 2973387Domain d3r4nb1: 3r4n B:9-225 [184803]
    Other proteins in same PDB: d3r4na2, d3r4nb2
    automated match to d1osfa_
    complexed with fu5

Details for d3r4nb1

PDB Entry: 3r4n (more details), 2 Å

PDB Description: Optimization of Potent, Selective, and Orally Bioavailable Pyrrolodinopyrimidine-containing Inhibitors of Heat Shock Protein 90. Identification of Development Candidate 2-amino-4-{4-chloro-2-[2-(4-fluoro-1H-pyrazol-1-yl)ethoxy]-6-methylphenyl}-N-(2,2-difluoropropyl)-5,7-dihydro-6H-pyrrolo[3,4-d]pyrimidine-6-carboxamide
PDB Compounds: (B:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3r4nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r4nb1 d.122.1.1 (B:9-225) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
hlkedqteyleerrikeivkkhsqfigypitlfveke

SCOPe Domain Coordinates for d3r4nb1:

Click to download the PDB-style file with coordinates for d3r4nb1.
(The format of our PDB-style files is described here.)

Timeline for d3r4nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r4nb2