SCOPe 2.01: Domain d3r42a_: 3r42 A:

Lineage for d3r42a_ (3r42 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.2: UEV domain [75383] (3 proteins)

6. Protein automated matches [191205] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189944] (2 PDB entries)

8. Domain d3r42a_: 3r42 A: [184796]
   automated match to d1uzxa_

Details for d3r42a_

PDB Entry: 3r42, 1.87 Å

PDB Description: Crystal structure of the yeast vps23 UEV domain in complex with a vps27 PSDP peptide

PDB Compounds: (A:) suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease

SCOPe Domain Sequences for d3r42a_:

Sequence; same for both SEQRES and ATOM records:

>d3r42a_ d.20.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkisvpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgtpqllls
iygtistgedgssphsipvimwvpsmypvkppfisinlenfdmntissslpiqeyidsng
wialpilhawdpaamnlimvvqelmsllheppqdqa

Timeline for d3r42a_:

• d3r42a_ is new in SCOPe 2.01-stable
  
• d3r42a_ appears in SCOPe 2.02
  
• d3r42a_ appears in the current release, SCOPe 2.08