Lineage for d3r0oc_ (3r0o C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113352Species Mycobacterium avium [TaxId:243243] [189433] (5 PDB entries)
  8. 2113362Domain d3r0oc_: 3r0o C: [184759]
    automated match to d1duba_
    complexed with edo, gol, k

Details for d3r0oc_

PDB Entry: 3r0o (more details), 2.1 Å

PDB Description: crystal structure of carnitinyl-coa hydratase from mycobacterium avium
PDB Compounds: (C:) Carnitinyl-CoA dehydratase

SCOPe Domain Sequences for d3r0oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r0oc_ c.14.1.0 (C:) automated matches {Mycobacterium avium [TaxId: 243243]}
vtrqaavverrgnvalitidrpdarnavngavstavgdaleeaqrdpevwavvitgagdk
sfcagadlkaisrgenlyhaehpewgfagyvhhfidkptiaavngtalgggselalasdl
viacesasfglpevkrgliagaggvfriveqlprkvalelvltgepmtasdalrwgline
vvpdgtvveaalalaeritcnaplsvqaskrvaygaddgiigaeepkwertireftellk
sedakegplafaekrqpvwkar

SCOPe Domain Coordinates for d3r0oc_:

Click to download the PDB-style file with coordinates for d3r0oc_.
(The format of our PDB-style files is described here.)

Timeline for d3r0oc_: