Lineage for d3r04a_ (3r04 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435373Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
    OPK group(?); PIM subfamily; serine/threonine kinase
  7. 1435374Species Human (Homo sapiens) [TaxId:9606] [118134] (59 PDB entries)
    Uniprot P11309 33-305 ! Uniprot P11309 32-308
  8. 1435376Domain d3r04a_: 3r04 A: [184753]
    automated match to d1xqza_
    complexed with imd, unq

Details for d3r04a_

PDB Entry: 3r04 (more details), 1.7 Å

PDB Description: The discovery of novel benzofuran-2-carboxylic acids as potent Pim-1 inhibitors
PDB Compounds: (A:) Proto-oncogene serine/threonine-protein kinase Pim-1

SCOPe Domain Sequences for d3r04a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r04a_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
esqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllk
kvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvlea
vrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewir
yhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalr
psdrptfeeiqnhpwmqdvllpqetaeihlh

SCOPe Domain Coordinates for d3r04a_:

Click to download the PDB-style file with coordinates for d3r04a_.
(The format of our PDB-style files is described here.)

Timeline for d3r04a_: