SCOPe 2.08: Domain d1qk1g1: 1qk1 G:1-102

Lineage for d1qk1g1 (1qk1 G:1-102)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Creatine kinase, N-domain [48036] (7 species)

7. Species Human (Homo sapiens), mitochondria [TaxId:9606] [48039] (1 PDB entry)

8. Domain d1qk1g1: 1qk1 G:1-102 [18472]
   Other proteins in same PDB: d1qk1a2, d1qk1b2, d1qk1c2, d1qk1d2, d1qk1e2, d1qk1f2, d1qk1g2, d1qk1h2
   complexed with po4

Details for d1qk1g1

PDB Entry: 1qk1, 2.7 Å

PDB Description: crystal structure of human ubiquitous mitochondrial creatine kinase

PDB Compounds: (G:) creatine kinase, ubiquitous mitochondrial

SCOPe Domain Sequences for d1qk1g1:

Sequence; same for both SEQRES and ATOM records:

>d1qk1g1 a.83.1.1 (G:1-102) Creatine kinase, N-domain {Human (Homo sapiens), mitochondria [TaxId: 9606]}
aaserrrlyppsaeypdlrkhnncmashltpavyarlcdkttptgwtldqciqtgvdnpg
hpfiktvgmvagdeetyevfadlfdpviqerhngydprtmkh

Timeline for d1qk1g1:

• d1qk1g1 first appeared (with stable ids) in SCOP 1.55
  
• d1qk1g1 appears in SCOPe 2.07