SCOPe 2.06: Domain d3qz3b_: 3qz3 B:

Lineage for d3qz3b_ (3qz3 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (27 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [189679] (1 PDB entry)

8. Domain d3qz3b_: 3qz3 B: [184710]
   automated match to d1euma_
   complexed with edo

Details for d3qz3b_

PDB Entry: 3qz3, 2.1 Å

PDB Description: The crystal structure of ferritin from Vibrio cholerae O1 biovar El Tor str. N16961

PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d3qz3b_:

Sequence; same for both SEQRES and ATOM records:

>d3qz3b_ a.25.1.1 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
mlsqamvehlneqinleffssnlylqmsawcedkgfdgaaeflrahaveemqhmqrlfty
vsetgalpilgaiaaprhdfaslgevfretyqheqkitqqinklahvaftsqdystfnfl
qwyvaeqheeeklfkgildklelvgedgkalffidkdlaalak

Timeline for d3qz3b_:

• d3qz3b_ first appeared in SCOPe 2.01
  
• d3qz3b_ appears in SCOPe 2.05
  
• d3qz3b_ appears in SCOPe 2.07
  
• d3qz3b_ appears in the current release, SCOPe 2.08