Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (27 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [189679] (1 PDB entry) |
Domain d3qz3b_: 3qz3 B: [184710] automated match to d1euma_ complexed with edo |
PDB Entry: 3qz3 (more details), 2.1 Å
SCOPe Domain Sequences for d3qz3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qz3b_ a.25.1.1 (B:) automated matches {Vibrio cholerae [TaxId: 243277]} mlsqamvehlneqinleffssnlylqmsawcedkgfdgaaeflrahaveemqhmqrlfty vsetgalpilgaiaaprhdfaslgevfretyqheqkitqqinklahvaftsqdystfnfl qwyvaeqheeeklfkgildklelvgedgkalffidkdlaalak
Timeline for d3qz3b_: