Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
Protein automated matches [191237] (3 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [189678] (5 PDB entries) |
Domain d3qygd_: 3qyg D: [184696] Other proteins in same PDB: d3qyga_, d3qygc_, d3qyge_, d3qygg_ automated match to d1ireb_ complexed with 3co, gol |
PDB Entry: 3qyg (more details), 2.3 Å
SCOPe Domain Sequences for d3qygd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qygd_ b.34.4.0 (D:) automated matches {Pseudomonas putida [TaxId: 303]} mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiqrmgp ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa
Timeline for d3qygd_: