SCOPe 2.06: Domain d3qydb_: 3qyd B:

Lineage for d3qydb_ (3qyd B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
   automatically mapped to Pfam PF00197

6. Protein automated matches [190504] (2 species)
   not a true protein

7. Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [187454] (12 PDB entries)

8. Domain d3qydb_: 3qyd B: [184693]
   automated match to d1wbca_

Details for d3qydb_

PDB Entry: 3qyd, 2.97 Å

PDB Description: Crystal structure of a recombinant chimeric trypsin inhibitor

PDB Compounds: (B:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d3qydb_:

Sequence; same for both SEQRES and ATOM records:

>d3qydb_ b.42.4.1 (B:) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssrlrsafiprgslvrlgfanppscaaspwwtvvdspqgpavklsqqklpekdiyvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks

Timeline for d3qydb_:

• d3qydb_ first appeared in SCOPe 2.01
  
• d3qydb_ appears in SCOPe 2.05
  
• d3qydb_ appears in SCOPe 2.07
  
• d3qydb_ appears in the current release, SCOPe 2.08