Class a: All alpha proteins [46456] (286 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) automatically mapped to Pfam PF02807 |
Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
Protein Creatine kinase, N-domain [48036] (7 species) |
Species Chicken (Gallus gallus), brain-type [TaxId:9031] [48038] (1 PDB entry) |
Domain d1qh4c1: 1qh4 C:2-102 [18464] Other proteins in same PDB: d1qh4a2, d1qh4b2, d1qh4c2, d1qh4d2 complexed with act, ca |
PDB Entry: 1qh4 (more details), 1.41 Å
SCOPe Domain Sequences for d1qh4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qh4c1 a.83.1.1 (C:2-102) Creatine kinase, N-domain {Chicken (Gallus gallus), brain-type [TaxId: 9031]} pfsnshnllkmkysvddeypdlsvhnnhmakvltldlykklrdrqtssgftlddviqtgv dnpghpfimtvgcvagdeesyevfkelfdpviedrhggykp
Timeline for d1qh4c1: