SCOPe 2.05: Domain d1qh4c1: 1qh4 C:2-102

Lineage for d1qh4c1 (1qh4 C:2-102)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Creatine kinase, N-domain [48036] (7 species)

7. Species Chicken (Gallus gallus), brain-type [TaxId:9031] [48038] (1 PDB entry)

8. Domain d1qh4c1: 1qh4 C:2-102 [18464]
   Other proteins in same PDB: d1qh4a2, d1qh4b2, d1qh4c2, d1qh4d2
   complexed with act, ca

Details for d1qh4c1

PDB Entry: 1qh4, 1.41 Å

PDB Description: crystal structure of chicken brain-type creatine kinase at 1.41 angstrom resolution

PDB Compounds: (C:) creatine kinase

SCOPe Domain Sequences for d1qh4c1:

Sequence; same for both SEQRES and ATOM records:

>d1qh4c1 a.83.1.1 (C:2-102) Creatine kinase, N-domain {Chicken (Gallus gallus), brain-type [TaxId: 9031]}
pfsnshnllkmkysvddeypdlsvhnnhmakvltldlykklrdrqtssgftlddviqtgv
dnpghpfimtvgcvagdeesyevfkelfdpviedrhggykp

Timeline for d1qh4c1:

• d1qh4c1 first appeared (with stable ids) in SCOP 1.55
  
• d1qh4c1 appears in SCOPe 2.04
  
• d1qh4c1 appears in SCOPe 2.06
  
• d1qh4c1 appears in the current release, SCOPe 2.08