SCOPe 2.03: Domain d3qu3b_: 3qu3 B:

Lineage for d3qu3b_ (3qu3 B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (41 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189892] (1 PDB entry)

8. Domain d3qu3b_: 3qu3 B: [184627]
   automated match to d1t2ka_
   complexed with edo, na

Details for d3qu3b_

PDB Entry: 3qu3, 1.3 Å

PDB Description: Crystal structure of IRF-7 DBD apo form

PDB Compounds: (B:) Interferon regulatory factor 7

SCOPe Domain Sequences for d3qu3b_:

Sequence; same for both SEQRES and ATOM records:

>d3qu3b_ a.4.5.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rvlfgdwllgevssgqyeglqwlneartvfrvpwkhfgrrdldeedaqifkawavargrw
ppsgvnlpppeaeaaerrerrgwktnfrcalhstgrfilrqdnsgdpvdphkvyels

Timeline for d3qu3b_:

• d3qu3b_ first appeared in SCOPe 2.01
  
• d3qu3b_ appears in SCOPe 2.02
  
• d3qu3b_ appears in SCOPe 2.04
  
• d3qu3b_ appears in the current release, SCOPe 2.08