Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (19 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189892] (1 PDB entry) |
Domain d3qu3b_: 3qu3 B: [184627] automated match to d1t2ka_ complexed with edo, na |
PDB Entry: 3qu3 (more details), 1.3 Å
SCOPe Domain Sequences for d3qu3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qu3b_ a.4.5.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rvlfgdwllgevssgqyeglqwlneartvfrvpwkhfgrrdldeedaqifkawavargrw ppsgvnlpppeaeaaerrerrgwktnfrcalhstgrfilrqdnsgdpvdphkvyels
Timeline for d3qu3b_: