Lineage for d3qtia_ (3qti A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220850Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1220851Species Human (Homo sapiens) [TaxId:9606] [103301] (22 PDB entries)
  8. 1220858Domain d3qtia_: 3qti A: [184620]
    Other proteins in same PDB: d3qtib_
    automated match to d1r0pa_
    complexed with 3qt, cl, gol

Details for d3qtia_

PDB Entry: 3qti (more details), 2 Å

PDB Description: c-Met Kinase in Complex with NVP-BVU972
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d3qtia_:

Sequence, based on SEQRES records: (download)

>d3qtia_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavks
lnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirn
ethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmyd
kefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfd
itvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvh
vnatyvnvk

Sequence, based on observed residues (ATOM records): (download)

>d3qtia_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldkihcavkslnri
tdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethn
ptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmydkefl
pvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdfditvyllqgrrllqpeyc
pdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnvk

SCOPe Domain Coordinates for d3qtia_:

Click to download the PDB-style file with coordinates for d3qtia_.
(The format of our PDB-style files is described here.)

Timeline for d3qtia_: